PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10014391m
Common NameCICLE_v10014391mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 744aa    MW: 80512.1 Da    PI: 6.8666
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10014391mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3789.9e-25158259199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      + +++ s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+F   + +
  Ciclev10014391m 158 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyS-QQRPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFL--RGE 248
                      99****************************963.3445679************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+++++r+
  Ciclev10014391m 249 DGELRLGIRRA 259
                      999*****997 PP

2Auxin_resp118.94e-39284365182
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                      +++a++ k +F++ YnPras+seF+++v+k++k+l ++++vGmRfkm+feted++err++G+++gv d+dpvrWp+SkWr+L
  Ciclev10014391m 284 VVDAIARKRAFSISYNPRASASEFIIPVNKFLKSLGHSFAVGMRFKMRFETEDAAERRYTGVIMGVGDMDPVRWPGSKWRCL 365
                      578999***************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.4E-40150260IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.58E-43150271IPR015300DNA-binding pseudobarrel domain
CDDcd100172.02E-22156258No hitNo description
SMARTSM010191.7E-23158260IPR003340B3 DNA binding domain
PfamPF023628.8E-23158259IPR003340B3 DNA binding domain
PROSITE profilePS5086313.408158260IPR003340B3 DNA binding domain
PfamPF065072.8E-34285365IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MVGLIDLNTT EDDENPSSGS LSPSSSSASA LSASGFALAP ASASASGVSL ELWHACAGPL  60
ISLPKRGSVV VYFPQGHLEH VSDFSAAASA AYDLPPHLFC RVADVKLHAE AASDEVYAQV  120
SLVPDELIEQ KVREGKIEED GDEESVEVVA KSSTPHMFCK TLTASDTSTH GGFSVPRRAA  180
EDCFPPLDYS QQRPSQELVA KDLHGLEWRF RHIYRGQPRR HLLTTGWSAF VNKKKLVSGD  240
AVLFLRGEDG ELRLGIRRAP HVKSGATFPS FCSQQSSPNS VTEVVDAIAR KRAFSISYNP  300
RASASEFIIP VNKFLKSLGH SFAVGMRFKM RFETEDAAER RYTGVIMGVG DMDPVRWPGS  360
KWRCLLVRWD DVESNRHTRV SPWEIEPSGS VCGSNNLITS GLKRTRIGLP SGKPEFPVPD  420
GIGVTDFGES LRFQKVLQGQ EILGFNTLYD GGDCQNLHPS EVRRGIPGSN GSGIAAIGDG  480
SRNLQVKSDI SYKGIGIGFG ESFRFHKVLQ GQEIFPKSPY GRAPTNNEAR SIGSLGISDG  540
VPVSGSRNRW SAVVPGYNTH MSPSAPPVQV SSPSSVLMFQ LASNPISNYN PPYSLNDQEK  600
EQRVNCQSFF HNSEIYGGKH ASSSFLDHSF VGGDQEVMDS IGQSNEHISP PLVGQPTVRG  660
SQDLVSSCKG SCRLFGFSLT EERHVANIED NAAPVASPLN PRSSFLSHVG QQFHPKPPVM  720
SKATGSNCTN GIMQHCLGNY DIY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1094039411361Auxin response factor 1
4ldw_A1e-1094039411361Auxin response factor 1
4ldw_B1e-1094039411361Auxin response factor 1
4ldx_A1e-1094039211363Auxin response factor 1
4ldx_B1e-1094039211363Auxin response factor 1
4ldy_A1e-1094039411361Auxin response factor 1
4ldy_B1e-1094039411361Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449420.10.0hypothetical protein CICLE_v10014391mg
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLV4UET90.0V4UET9_9R
STRINGVIT_10s0003g00420.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein